SCOP 1.75: Domain d2oa8a1: 2oa8 A:5-234

Lineage for d2oa8a1 (2oa8 A:5-234)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159632] (6 PDB entries)
   Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234

8. Domain d2oa8a1: 2oa8 A:5-234 [148693]
   automatically matched to 2IOC A:5-234
   complexed with ca

Details for d2oa8a1

PDB Entry: 2oa8, 2.1 Å

PDB Description: Crystal Structure of mTREX1 with ssDNA

PDB Compounds: (A:) Three prime repair exonuclease 1

SCOP Domain Sequences for d2oa8a1:

Sequence, based on SEQRES records:

>d2oa8a1 c.55.3.5 (A:5-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvv
dklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvah
ngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiyt
rlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d2oa8a1 c.55.3.5 (A:5-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
tlphghmqtlifldleatglpssrpevtelcllavhrralentqghpppvprpprvvdkl
slciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngd
rydfpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdsh
taegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d2oa8a1:

• d2oa8a1 is new in SCOP 1.75
  
• d2oa8a1 is called d2oa8a_ in SCOPe 2.01
  
• d2oa8a1 appears in the current release, SCOPe 2.08, called d2oa8a2