SCOPe 2.07: Domain d2oa4a1: 2oa4 A:1-93

Lineage for d2oa4a1 (2oa4 A:1-93)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.3: SPO1678-like [158345] (1 protein)
   Pfam PF06627; DUF1153

6. Protein Uncharacterized protein SPO1678 [158346] (1 species)

7. Species Silicibacter pomeroyi [TaxId:89184] [158347] (1 PDB entry)
   Uniprot Q5LST8 1-93

8. Domain d2oa4a1: 2oa4 A:1-93 [148690]
   Other proteins in same PDB: d2oa4a2

Details for d2oa4a1

PDB Entry: 2oa4

PDB Description: Solution NMR Structure: Northeast Structural Genomics Consortium Target SiR5

PDB Compounds: (A:) SiR5

SCOPe Domain Sequences for d2oa4a1:

Sequence; same for both SEQRES and ATOM records:

>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]}
mmflrkvegprsvtlpdgsimtradlppantrrwvasrkiavvrgviyglitlaeakqty
glsdeefnswvsalaehgkdalkvtalkkyrql

Timeline for d2oa4a1:

• d2oa4a1 first appeared in SCOP 1.75
  
• d2oa4a1 appears in SCOPe 2.06