Lineage for d2o9xa1 (2o9x A:1-153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736108Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2736109Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2736110Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2736119Protein Reductase assembly protein AF0173 [158815] (1 species)
  7. 2736120Species Archaeoglobus fulgidus [TaxId:2234] [158816] (1 PDB entry)
    Uniprot O30064 1-153
  8. 2736121Domain d2o9xa1: 2o9x A:1-153 [148689]
    Other proteins in same PDB: d2o9xa2

Details for d2o9xa1

PDB Entry: 2o9x (more details), 3.4 Å

PDB Description: crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus
PDB Compounds: (A:) Reductase, assembly protein

SCOPe Domain Sequences for d2o9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9xa1 a.184.1.1 (A:1-153) Reductase assembly protein AF0173 {Archaeoglobus fulgidus [TaxId: 2234]}
mrehlklfslifsypdedklgkaialaegiglteiaqtlkqvdiealqveytslfisshp
svpcppyqsyfeegsvygkaslraaelyskyglnyvyeseppdhisveleflsmnpells
dfrdwflefakcveekseiyatfarafrkflek

SCOPe Domain Coordinates for d2o9xa1:

Click to download the PDB-style file with coordinates for d2o9xa1.
(The format of our PDB-style files is described here.)

Timeline for d2o9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o9xa2