Lineage for d2o9oa2 (2o9o A:241-308)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2186175Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2186176Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2186324Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2186325Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (8 PDB entries)
    Uniprot Q7YS85
  8. 2186329Domain d2o9oa2: 2o9o A:241-308 [148687]
    Other proteins in same PDB: d2o9oa1
    automated match to d1tfva2

Details for d2o9oa2

PDB Entry: 2o9o (more details), 2.8 Å

PDB Description: crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2o9oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9oa2 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

SCOPe Domain Coordinates for d2o9oa2:

Click to download the PDB-style file with coordinates for d2o9oa2.
(The format of our PDB-style files is described here.)

Timeline for d2o9oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o9oa1