Lineage for d2o9oa2 (2o9o A:240-307)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) 
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
secreted during involution
Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (3 PDB entries)
Uniprot Q7YS85
Domain d2o9oa2: 2o9o A:240-307 [148687]
Other proteins in same PDB: d2o9oa1
automatically matched to d1owqa2
Details for d2o9oa2
PDB Entry: 2o9o (more details), 2.8 Å
PDB Description: crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1SCOPe Domain Sequences for d2o9oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9oa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
fgrsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay
SCOPe Domain Coordinates for d2o9oa2:
Click to download the PDB-style file with coordinates for d2o9oa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o9oa2:
- d2o9oa2 first appeared in SCOP 1.75
- d2o9oa2 appears in SCOPe 2.02
- d2o9oa2 appears in the current release, SCOPe 2.08
View in 3D
