Lineage for d2o9oa2 (2o9o A:240-307)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857703Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 857704Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 857844Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 857845Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (3 PDB entries)
    Uniprot Q7YS85
  8. 857846Domain d2o9oa2: 2o9o A:240-307 [148687]
    Other proteins in same PDB: d2o9oa1
    automatically matched to d1owqa2
    complexed with man, nag

Details for d2o9oa2

PDB Entry: 2o9o (more details), 2.8 Å

PDB Description: crystal structure of the buffalo secretory signalling glycoprotein at 2.8 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOP Domain Sequences for d2o9oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9oa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
fgrsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d2o9oa2:

Click to download the PDB-style file with coordinates for d2o9oa2.
(The format of our PDB-style files is described here.)

Timeline for d2o9oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o9oa1