| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
| Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
| Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
| Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (9 PDB entries) Uniprot Q7YS85 |
| Domain d2o9oa2: 2o9o A:241-308 [148687] Other proteins in same PDB: d2o9oa1 automated match to d1tfva2 |
PDB Entry: 2o9o (more details), 2.8 Å
SCOPe Domain Sequences for d2o9oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9oa2 d.26.3.1 (A:241-308) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd
Timeline for d2o9oa2: