Lineage for d2o9ca2 (2o9c A:4-130)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210948Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 2210949Protein Bacteriophytochrome BphP [160672] (3 species)
  7. 2210950Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries)
    Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130
  8. 2210951Domain d2o9ca2: 2o9c A:4-130 [148685]
    Other proteins in same PDB: d2o9ca1, d2o9ca3
    automated match to d2o9ba2
    complexed with lbv

Details for d2o9ca2

PDB Entry: 2o9c (more details), 1.45 Å

PDB Description: crystal structure of bacteriophytochrome chromophore binding domain at 1.45 angstrom resolution
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d2o9ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
dplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflg
qeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgelli
lefepte

SCOPe Domain Coordinates for d2o9ca2:

Click to download the PDB-style file with coordinates for d2o9ca2.
(The format of our PDB-style files is described here.)

Timeline for d2o9ca2: