Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
Protein Bacteriophytochrome BphP [160672] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries) Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130 |
Domain d2o9ca2: 2o9c A:4-130 [148685] Other proteins in same PDB: d2o9ca1, d2o9ca3 automated match to d2o9ba2 complexed with lbv |
PDB Entry: 2o9c (more details), 1.45 Å
SCOPe Domain Sequences for d2o9ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} dplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflg qeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgelli lefepte
Timeline for d2o9ca2: