![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
![]() | Protein Bacteriophytochrome BphP [160672] (2 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries) Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130 |
![]() | Domain d2o9ca2: 2o9c A:4-130 [148685] Other proteins in same PDB: d2o9ca1 automatically matched to 2O9B A:4-130 complexed with lbv; mutant |
PDB Entry: 2o9c (more details), 1.45 Å
SCOP Domain Sequences for d2o9ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} dplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflg qeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgelli lefepte
Timeline for d2o9ca2: