SCOP 1.75: Domain d2o9ca2: 2o9c A:4-130

Lineage for d2o9ca2 (2o9c A:4-130)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
   Pfam PF08446; PAS_2

6. Protein Bacteriophytochrome BphP [160672] (2 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries)
   Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130

8. Domain d2o9ca2: 2o9c A:4-130 [148685]
   Other proteins in same PDB: d2o9ca1
   automatically matched to 2O9B A:4-130
   complexed with lbv; mutant

Details for d2o9ca2

PDB Entry: 2o9c, 1.45 Å

PDB Description: crystal structure of bacteriophytochrome chromophore binding domain at 1.45 angstrom resolution

PDB Compounds: (A:) Bacteriophytochrome

SCOP Domain Sequences for d2o9ca2:

Sequence; same for both SEQRES and ATOM records:

>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
dplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflg
qeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgelli
lefepte

Timeline for d2o9ca2:

• d2o9ca2 is new in SCOP 1.75
  
• d2o9ca2 appears in SCOPe 2.01
  
• d2o9ca2 appears in the current release, SCOPe 2.08