Lineage for d2o9ca1 (2o9c A:135-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970141Protein Bacteriophytochrome BphP [160661] (3 species)
  7. 2970142Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries)
    Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325
  8. 2970146Domain d2o9ca1: 2o9c A:135-321 [148684]
    Other proteins in same PDB: d2o9ca2, d2o9ca3
    automated match to d2o9ba1
    complexed with lbv

Details for d2o9ca1

PDB Entry: 2o9c (more details), 1.45 Å

PDB Description: crystal structure of bacteriophytochrome chromophore binding domain at 1.45 angstrom resolution
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d2o9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ca1 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg
lhaflghrfpasdipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr
atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl
qvqvkea

SCOPe Domain Coordinates for d2o9ca1:

Click to download the PDB-style file with coordinates for d2o9ca1.
(The format of our PDB-style files is described here.)

Timeline for d2o9ca1: