Lineage for d2o8sb1 (2o8s B:54-278)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016923Fold a.295: AGR_C_984p-like [158836] (1 superfamily)
    multihelical, consists of two subdomains; duplication: there are two 5-helical structural repeats, one in each subdomain
  4. 2016924Superfamily a.295.1: AGR_C_984p-like [158837] (1 family) (S)
  5. 2016925Family a.295.1.1: AGR_C_984p-like [158838] (1 protein)
    Pfam PF06748; DUF1217
  6. 2016926Protein Uncharacterized protein AGR_C_984p [158839] (1 species)
  7. 2016927Species Agrobacterium tumefaciens [TaxId:358] [158840] (1 PDB entry)
    Uniprot Q7D182 54-278
  8. 2016929Domain d2o8sb1: 2o8s B:54-278 [148681]
    automated match to d2o8sa1
    complexed with so4

Details for d2o8sb1

PDB Entry: 2o8s (more details), 2.4 Å

PDB Description: X-ray Crystal Structure of Protein AGR_C_984 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR120.
PDB Compounds: (B:) AGR_C_984p

SCOPe Domain Sequences for d2o8sb1:

Sequence, based on SEQRES records: (download)

>d2o8sb1 a.295.1.1 (B:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]}
vtstytsyrlisqdigkslervskqpdvareteyyrekigsvksiddfmadtrlynyalk
ahgledmayakafirkvltegasdknafanklsdnryaelaksldfaglgaaatateaak
sgvignyarqtleqeagddnngvrlalyferkaptiksgldfladdalaqvfrttfnlpd
afaaadvdkqaalieksinikdlqdpekvgkllerftimwemqnp

Sequence, based on observed residues (ATOM records): (download)

>d2o8sb1 a.295.1.1 (B:54-278) Uncharacterized protein AGR_C_984p {Agrobacterium tumefaciens [TaxId: 358]}
vtstytsyrlisqdigkslervskqpdvareteyyrekigsvksiddfmadtrlynyalk
ahgledmayakafirkvltegasdknafanklsdnryaelaksldfaglgaaatateaak
sgvignyarqtleqeagddnngvrlalyferkaptiksgldfladdalaqvfrttfnlaa
dvdkqaalieksinikdlqdpekvgkllerftimwemqnp

SCOPe Domain Coordinates for d2o8sb1:

Click to download the PDB-style file with coordinates for d2o8sb1.
(The format of our PDB-style files is described here.)

Timeline for d2o8sb1: