Lineage for d2o8ob2 (2o8o B:1893-2008)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039933Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
    PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)
  6. 2039934Protein Class 1 collagenase [267633] (1 species)
  7. 2039935Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)
  8. 2039939Domain d2o8ob2: 2o8o B:1893-2008 [148678]
    Other proteins in same PDB: d2o8ob3
    automated match to d1nqdb_
    complexed with ca, cl

Details for d2o8ob2

PDB Entry: 2o8o (more details), 1.35 Å

PDB Description: crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium
PDB Compounds: (B:) collagenase

SCOPe Domain Sequences for d2o8ob2:

Sequence, based on SEQRES records: (download)

>d2o8ob2 b.18.1.36 (B:1893-2008) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
gneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdef
gvtwtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

Sequence, based on observed residues (ATOM records): (download)

>d2o8ob2 b.18.1.36 (B:1893-2008) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
gneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdef
gvtwtlhpesritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

SCOPe Domain Coordinates for d2o8ob2:

Click to download the PDB-style file with coordinates for d2o8ob2.
(The format of our PDB-style files is described here.)

Timeline for d2o8ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o8ob3
View in 3D
Domains from other chains:
(mouse over for more information)
d2o8oa_