Lineage for d2o8oa_ (2o8o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774937Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
    PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)
  6. 2774938Protein Class 1 collagenase [267633] (1 species)
  7. 2774939Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)
  8. 2774944Domain d2o8oa_: 2o8o A: [148677]
    Other proteins in same PDB: d2o8ob3
    automated match to d1nqdb_
    complexed with ca, cl

Details for d2o8oa_

PDB Entry: 2o8o (more details), 1.35 Å

PDB Description: crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.35 angstrom resolution in presence of calcium
PDB Compounds: (A:) collagenase

SCOPe Domain Sequences for d2o8oa_:

Sequence, based on SEQRES records: (download)

>d2o8oa_ b.18.1.36 (A:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
klkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdefgvt
wtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

Sequence, based on observed residues (ATOM records): (download)

>d2o8oa_ b.18.1.36 (A:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
klkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdefgvt
wtlhpesdritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

SCOPe Domain Coordinates for d2o8oa_:

Click to download the PDB-style file with coordinates for d2o8oa_.
(The format of our PDB-style files is described here.)

Timeline for d2o8oa_: