Lineage for d2o8ia1 (2o8i A:1-165)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016835Fold a.288: UraD-like [158693] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2016836Superfamily a.288.1: UraD-Like [158694] (1 family) (S)
    automatically mapped to Pfam PF09349
  5. 2016837Family a.288.1.1: UraD-like [158695] (2 protein domains)
    Pfam PF09349; OHCU decarboxylase (formerly DUF1991)
  6. 2016838Protein Hypothetical protein Atu2327 [158699] (1 species)
  7. 2016839Species Agrobacterium tumefaciens [TaxId:358] [158700] (1 PDB entry)
    Uniprot Q8UD01 1-165
  8. 2016840Domain d2o8ia1: 2o8i A:1-165 [148676]

Details for d2o8ia1

PDB Entry: 2o8i (more details), 2.6 Å

PDB Description: Crystal structure of protein Atu2327 from Agrobacterium tumefaciens str. C58
PDB Compounds: (A:) Hypothetical protein Atu2327

SCOPe Domain Sequences for d2o8ia1:

Sequence, based on SEQRES records: (download)

>d2o8ia1 a.288.1.1 (A:1-165) Hypothetical protein Atu2327 {Agrobacterium tumefaciens [TaxId: 358]}
mvtreefvarfggvfehspfiaeraydaggagleltakavhgalcaqfrvaseaerlgvl
rahpdlagklaiageltadsrneqagagldrlspqeharftqlnsaytekfgfpfiiavk
glnrhdilsafdtridnnaaqefatatgqvekiawlrlasmlpeg

Sequence, based on observed residues (ATOM records): (download)

>d2o8ia1 a.288.1.1 (A:1-165) Hypothetical protein Atu2327 {Agrobacterium tumefaciens [TaxId: 358]}
mvtreefvarfggvfehspfiaeraydaggagleltakavhgalcaqfrvaseaerlgvl
rahpdlagklaiageltgldrlspqeharftqlnsaytekfgfpfiiavkglnrhdilsa
fdtridnnaaqefatatgqvekiawlrlasmlpeg

SCOPe Domain Coordinates for d2o8ia1:

Click to download the PDB-style file with coordinates for d2o8ia1.
(The format of our PDB-style files is described here.)

Timeline for d2o8ia1: