SCOPe 2.08: Domain d2o8gb_: 2o8g B:

Lineage for d2o8gb_ (2o8g B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160869] (2 PDB entries)

8. Domain d2o8gb_: 2o8g B: [148675]
   automated match to d3c5wc_
   complexed with mn

Details for d2o8gb_

PDB Entry: 2o8g, 2.5 Å

PDB Description: rat pp1c gamma complexed with mouse inhibitor-2

PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d2o8gb_:

Sequence; same for both SEQRES and ATOM records:

>d2o8gb_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpae

Timeline for d2o8gb_:

• d2o8gb_ first appeared in SCOP 1.75, called d2o8gb1
  
• d2o8gb_ appears in SCOPe 2.07