![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Transcriptional regulator Cgl1640/Cg1846 [158802] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [158803] (1 PDB entry) Uniprot Q8NQ14 79-188 |
![]() | Domain d2o7ta2: 2o7t A:79-188 [148671] Other proteins in same PDB: d2o7ta1 complexed with unl |
PDB Entry: 2o7t (more details), 2.1 Å
SCOPe Domain Sequences for d2o7ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o7ta2 a.121.1.1 (A:79-188) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} tdpegvwtsfnqllfdrglgslvpalapeslddlpdevsalrrttekntttlinlakqhg lvhhdiapgtyivglitisrppitalatisenshkallglylsglkhgmm
Timeline for d2o7ta2: