![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Transcriptional regulator Cgl1640/Cg1846 [158256] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [158257] (1 PDB entry) Uniprot Q8NQ14 1-78 |
![]() | Domain d2o7ta1: 2o7t A:1-78 [148670] Other proteins in same PDB: d2o7ta2 complexed with unl |
PDB Entry: 2o7t (more details), 2.1 Å
SCOPe Domain Sequences for d2o7ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]} mradalkrrehiitttcnlyrthhhdsltmeniaeqagvgvatlyrnfpdrftldmacaq ylfnvvislqlqaistfp
Timeline for d2o7ta1: