Lineage for d2o7ta1 (2o7t A:1-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692505Protein Transcriptional regulator Cgl1640/Cg1846 [158256] (1 species)
  7. 2692506Species Corynebacterium glutamicum [TaxId:1718] [158257] (1 PDB entry)
    Uniprot Q8NQ14 1-78
  8. 2692507Domain d2o7ta1: 2o7t A:1-78 [148670]
    Other proteins in same PDB: d2o7ta2
    complexed with unl

Details for d2o7ta1

PDB Entry: 2o7t (more details), 2.1 Å

PDB Description: crystal structure of a tetr family transcriptional regulator (ncgl1578, cgl1640) from corynebacterium glutamicum at 2.10 a resolution
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2o7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]}
mradalkrrehiitttcnlyrthhhdsltmeniaeqagvgvatlyrnfpdrftldmacaq
ylfnvvislqlqaistfp

SCOPe Domain Coordinates for d2o7ta1:

Click to download the PDB-style file with coordinates for d2o7ta1.
(The format of our PDB-style files is described here.)

Timeline for d2o7ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o7ta2