SCOPe 2.08: Domain d2o7ma_: 2o7m A:

Lineage for d2o7ma_ (2o7m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein automated matches [190411] (4 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries)

8. Domain d2o7ma_: 2o7m A: [148668]
   automated match to d1t9ib_

Details for d2o7ma_

PDB Entry: 2o7m, 2 Å

PDB Description: The C-terminal loop of the homing endonuclease I-CreI is essential for DNA binding and cleavage. Identification of a novel site for specificity engineering in the I-CreI scaffold

PDB Compounds: (A:) DNA endonuclease I-crei

SCOPe Domain Sequences for d2o7ma_:

Sequence; same for both SEQRES and ATOM records:

>d2o7ma_ d.95.2.1 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravlds

Timeline for d2o7ma_:

• d2o7ma_ first appeared in SCOP 1.75, called d2o7ma1
  
• d2o7ma_ appears in SCOPe 2.07