SCOP 1.75: Domain d2o7cd1: 2o7c D:1501-1898

Lineage for d2o7cd1 (2o7c D:1501-1898)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (9 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)

6. Protein Methionine gamma-lyase, MGL [64126] (4 species)

7. Species Pseudomonas putida [TaxId:303] [75271] (5 PDB entries)
   Uniprot P13254

8. Domain d2o7cd1: 2o7c D:1501-1898 [148666]
   automatically matched to d1pg8a_
   complexed with so4

Details for d2o7cd1

PDB Entry: 2o7c, 1.7 Å

PDB Description: Crystal structure of L-methionine-lyase from Pseudomonas

PDB Compounds: (D:) methionine gamma-lyase

SCOP Domain Sequences for d2o7cd1:

Sequence; same for both SEQRES and ATOM records:

>d2o7cd1 c.67.1.3 (D:1501-1898) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

Timeline for d2o7cd1:

• d2o7cd1 is new in SCOP 1.75
  
• d2o7cd1 is called d2o7cd_ in SCOPe 2.01
  
• d2o7cd1 appears in the current release, SCOPe 2.08, called d2o7cd_