![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein automated matches [190399] (10 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [187269] (1 PDB entry) |
![]() | Domain d2o7cd_: 2o7c D: [148666] automated match to d1pg8a_ complexed with so4 |
PDB Entry: 2o7c (more details), 1.7 Å
SCOPe Domain Sequences for d2o7cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o7cd_ c.67.1.3 (D:) automated matches {Pseudomonas putida [TaxId: 303]} mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt peerahygiseglvrlsvglediddlladvqqalkasa
Timeline for d2o7cd_: