Lineage for d2o7cb1 (2o7c B:501-898)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840802Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 840934Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 840937Species Pseudomonas putida [TaxId:303] [75271] (5 PDB entries)
    Uniprot P13254
  8. 840947Domain d2o7cb1: 2o7c B:501-898 [148664]
    automatically matched to d1pg8a_
    complexed with so4

Details for d2o7cb1

PDB Entry: 2o7c (more details), 1.7 Å

PDB Description: Crystal structure of L-methionine-lyase from Pseudomonas
PDB Compounds: (B:) methionine gamma-lyase

SCOP Domain Sequences for d2o7cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7cb1 c.67.1.3 (B:501-898) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

SCOP Domain Coordinates for d2o7cb1:

Click to download the PDB-style file with coordinates for d2o7cb1.
(The format of our PDB-style files is described here.)

Timeline for d2o7cb1: