Lineage for d2o74a1 (2o74 A:2-166)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781450Fold a.288: UraD-like [158693] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 781451Superfamily a.288.1: UraD-Like [158694] (1 family) (S)
  5. 781452Family a.288.1.1: UraD-like [158695] (2 proteins)
    Pfam PF09349; OHCU decarboxylase (formerly DUF1991)
  6. 781456Protein OHCU decarboxylase, UraD [158696] (2 species)
    2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
  7. 781459Species Zebrafish (Brachydanio rerio) [TaxId:7955] [158698] (3 PDB entries)
    Uniprot A1L259 2-166
  8. 781466Domain d2o74a1: 2o74 A:2-166 [148657]
    automatically matched to 2O70 A:2-166
    complexed with gun

Details for d2o74a1

PDB Entry: 2o74 (more details), 1.8 Å

PDB Description: Structure of OHCU decarboxylase in complex with guanine
PDB Compounds: (A:) OHCU decarboxylase

SCOP Domain Sequences for d2o74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o74a1 a.288.1.1 (A:2-166) OHCU decarboxylase, UraD {Zebrafish (Brachydanio rerio) [TaxId: 7955]}
dinvvnalayedfvklfgnvvekcplisaaiwsyrpfkdladiearisefihslpdsgke
gilrchpdlagrdlqsgtltpesqeeqsqagmttldsaeivhmyrlnseykerfgfpfvi
carlnnkadivrqlserlknrrtaelecaieevkkicslrlhsiv

SCOP Domain Coordinates for d2o74a1:

Click to download the PDB-style file with coordinates for d2o74a1.
(The format of our PDB-style files is described here.)

Timeline for d2o74a1: