![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.288: UraD-like [158693] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.288.1: UraD-Like [158694] (1 family) ![]() automatically mapped to Pfam PF09349 |
![]() | Family a.288.1.1: UraD-like [158695] (2 proteins) Pfam PF09349; OHCU decarboxylase (formerly DUF1991) |
![]() | Protein OHCU decarboxylase, UraD [158696] (2 species) 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [158698] (3 PDB entries) Uniprot A1L259 2-166 |
![]() | Domain d2o73c_: 2o73 C: [148653] automated match to d2o70a1 complexed with 2al |
PDB Entry: 2o73 (more details), 1.8 Å
SCOPe Domain Sequences for d2o73c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o73c_ a.288.1.1 (C:) OHCU decarboxylase, UraD {Zebrafish (Danio rerio) [TaxId: 7955]} mdinvvnalayedfvklfgnvvekcplisaaiwsyrpfkdladiearisefihslpdsgk egilrchpdlagrdlqsgtltpesqeeqsqagmttldsaeivhmyrlnseykerfgfpfv icarlnnkadivrqlserlknrrtaelecaieevkkicslrlhsivl
Timeline for d2o73c_: