Lineage for d2o6ub_ (2o6u B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187776Protein Hypothetical thioesterase PA5185 [143158] (1 species)
  7. 2187777Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
    Uniprot Q9HU04 5-146
  8. 2187789Domain d2o6ub_: 2o6u B: [148644]
    automated match to d2o6ta_

Details for d2o6ub_

PDB Entry: 2o6u (more details), 3.01 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- new crystal form.
PDB Compounds: (B:) thioesterase

SCOPe Domain Sequences for d2o6ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6ub_ d.38.1.1 (B:) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
srpvaipqelrdalaalqs

SCOPe Domain Coordinates for d2o6ub_:

Click to download the PDB-style file with coordinates for d2o6ub_.
(The format of our PDB-style files is described here.)

Timeline for d2o6ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o6ua_