SCOP 1.75: Domain d2o6ub1: 2o6u B:6-144

Lineage for d2o6ub1 (2o6u B:6-144)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.1: 4HBT-like [54638] (18 proteins)
   Pfam PF03061

6. Protein Hypothetical thioesterase PA5185 [143158] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
   Uniprot Q9HU04 5-146

8. Domain d2o6ub1: 2o6u B:6-144 [148644]
   automatically matched to d2av9a1

Details for d2o6ub1

PDB Entry: 2o6u, 3.01 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- new crystal form.

PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2o6ub1:

Sequence; same for both SEQRES and ATOM records:

>d2o6ub1 d.38.1.1 (B:6-144) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
srpvaipqelrdalaalqs

Timeline for d2o6ub1:

• d2o6ub1 is new in SCOP 1.75
  
• d2o6ub1 appears in SCOPe 2.01
  
• d2o6ub1 appears in the current release, SCOPe 2.08, called d2o6ub_