Lineage for d2o6ub1 (2o6u B:6-144)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858683Protein Hypothetical thioesterase PA5185 [143158] (1 species)
  7. 858684Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
    Uniprot Q9HU04 5-146
  8. 858707Domain d2o6ub1: 2o6u B:6-144 [148644]
    automatically matched to d2av9a1

Details for d2o6ub1

PDB Entry: 2o6u (more details), 3.01 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- new crystal form.
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2o6ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6ub1 d.38.1.1 (B:6-144) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
srpvaipqelrdalaalqs

SCOP Domain Coordinates for d2o6ub1:

Click to download the PDB-style file with coordinates for d2o6ub1.
(The format of our PDB-style files is described here.)

Timeline for d2o6ub1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o6ua1