![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein Hypothetical thioesterase PA5185 [143158] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries) Uniprot Q9HU04 5-146 |
![]() | Domain d2o6te_: 2o6t E: [148639] Other proteins in same PDB: d2o6ta3, d2o6ti3 automated match to d2av9a1 complexed with cl |
PDB Entry: 2o6t (more details), 2.55 Å
SCOPe Domain Sequences for d2o6te_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6te_ d.38.1.1 (E:) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr ssrpvaipqelrdalaalqs
Timeline for d2o6te_: