Lineage for d2o6ta_ (2o6t A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1409953Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1410019Protein Hypothetical thioesterase PA5185 [143158] (1 species)
  7. 1410020Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
    Uniprot Q9HU04 5-146
  8. 1410025Domain d2o6ta_: 2o6t A: [148637]
    automated match to d2av9a1
    complexed with cl

Details for d2o6ta_

PDB Entry: 2o6t (more details), 2.55 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221).
PDB Compounds: (A:) thioesterase

SCOPe Domain Sequences for d2o6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6ta_ d.38.1.1 (A:) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
hmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
fverrssrpvaipqelrdalaalqss

SCOPe Domain Coordinates for d2o6ta_:

Click to download the PDB-style file with coordinates for d2o6ta_.
(The format of our PDB-style files is described here.)

Timeline for d2o6ta_: