Lineage for d2o6pb_ (2o6p B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525010Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1525011Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 1525021Protein Iron-regulated surface determinant protein C, IsdC [158913] (1 species)
  7. 1525022Species Staphylococcus aureus [TaxId:1280] [158914] (1 PDB entry)
    Uniprot Q7A654 29-150
  8. 1525024Domain d2o6pb_: 2o6p B: [148636]
    automated match to d2o6pa1
    complexed with cl, hem, zn

Details for d2o6pb_

PDB Entry: 2o6p (more details), 1.5 Å

PDB Description: crystal structure of the heme-isdc complex
PDB Compounds: (B:) Iron-regulated surface determinant protein C

SCOPe Domain Sequences for d2o6pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6pb_ b.1.28.1 (B:) Iron-regulated surface determinant protein C, IsdC {Staphylococcus aureus [TaxId: 1280]}
gsdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghk
eniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngpt

SCOPe Domain Coordinates for d2o6pb_:

Click to download the PDB-style file with coordinates for d2o6pb_.
(The format of our PDB-style files is described here.)

Timeline for d2o6pb_: