Lineage for d2o6pb1 (2o6p B:29-146)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1112528Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1112529Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 1112539Protein Iron-regulated surface determinant protein C, IsdC [158913] (1 species)
  7. 1112540Species Staphylococcus aureus [TaxId:1280] [158914] (1 PDB entry)
    Uniprot Q7A654 29-150
  8. 1112542Domain d2o6pb1: 2o6p B:29-146 [148636]
    automatically matched to 2O6P A:29-150
    complexed with cl, hem, zn

Details for d2o6pb1

PDB Entry: 2o6p (more details), 1.5 Å

PDB Description: crystal structure of the heme-isdc complex
PDB Compounds: (B:) Iron-regulated surface determinant protein C

SCOPe Domain Sequences for d2o6pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6pb1 b.1.28.1 (B:29-146) Iron-regulated surface determinant protein C, IsdC {Staphylococcus aureus [TaxId: 1280]}
sdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghke
niiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngpt

SCOPe Domain Coordinates for d2o6pb1:

Click to download the PDB-style file with coordinates for d2o6pb1.
(The format of our PDB-style files is described here.)

Timeline for d2o6pb1: