| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
| Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
| Protein Iron-regulated surface determinant protein C, IsdC [158913] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [158914] (1 PDB entry) Uniprot Q7A654 29-150 |
| Domain d2o6pb1: 2o6p B:29-146 [148636] automatically matched to 2O6P A:29-150 complexed with cl, hem, zn |
PDB Entry: 2o6p (more details), 1.5 Å
SCOPe Domain Sequences for d2o6pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6pb1 b.1.28.1 (B:29-146) Iron-regulated surface determinant protein C, IsdC {Staphylococcus aureus [TaxId: 1280]}
sdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghke
niiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngpt
Timeline for d2o6pb1: