SCOP 1.75: Domain d2o6pb1: 2o6p B:29-146

Lineage for d2o6pb1 (2o6p B:29-146)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (1 family)

5. Family b.1.28.1: NEAT domain [158912] (3 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein Iron-regulated surface determinant protein C, IsdC [158913] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158914] (1 PDB entry)
   Uniprot Q7A654 29-150

8. Domain d2o6pb1: 2o6p B:29-146 [148636]
   automatically matched to 2O6P A:29-150
   complexed with cl, hem, zn

Details for d2o6pb1

PDB Entry: 2o6p, 1.5 Å

PDB Description: crystal structure of the heme-isdc complex

PDB Compounds: (B:) Iron-regulated surface determinant protein C

SCOP Domain Sequences for d2o6pb1:

Sequence; same for both SEQRES and ATOM records:

>d2o6pb1 b.1.28.1 (B:29-146) Iron-regulated surface determinant protein C, IsdC {Staphylococcus aureus [TaxId: 1280]}
sdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghke
niiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngpt

Timeline for d2o6pb1:

• d2o6pb1 is new in SCOP 1.75
  
• d2o6pb1 appears in SCOPe 2.01
  
• d2o6pb1 appears in the current release, SCOPe 2.08, called d2o6pb2