![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.28: NEAT domain-like [158911] (1 family) ![]() |
![]() | Family b.1.28.1: NEAT domain [158912] (3 proteins) Pfam PF05031; iron transport-associated domain |
![]() | Protein Iron-regulated surface determinant protein C, IsdC [158913] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [158914] (1 PDB entry) Uniprot Q7A654 29-150 |
![]() | Domain d2o6pa1: 2o6p A:29-150 [148635] complexed with cl, hem, zn |
PDB Entry: 2o6p (more details), 1.5 Å
SCOP Domain Sequences for d2o6pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6pa1 b.1.28.1 (A:29-150) Iron-regulated surface determinant protein C, IsdC {Staphylococcus aureus [TaxId: 1280]} sdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghke niiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngptdv ag
Timeline for d2o6pa1: