Lineage for d2o6ka1 (2o6k A:4-73)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716767Superfamily a.60.15: YozE-like [140652] (1 family) (S)
  5. 2716768Family a.60.15.1: YozE-like [140653] (2 proteins)
    Pfam PF06855; DUF1250
  6. 2716772Protein Uncharacterized protein MW1311 [158542] (1 species)
  7. 2716773Species Staphylococcus aureus [TaxId:1280] [158543] (1 PDB entry)
    Uniprot Q7BEF3 4-73
  8. 2716774Domain d2o6ka1: 2o6k A:4-73 [148632]
    Other proteins in same PDB: d2o6ka2, d2o6kb3

Details for d2o6ka1

PDB Entry: 2o6k (more details), 2.1 Å

PDB Description: crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
PDB Compounds: (A:) UPF0346 protein MW1311

SCOPe Domain Sequences for d2o6ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6ka1 a.60.15.1 (A:4-73) Uncharacterized protein MW1311 {Staphylococcus aureus [TaxId: 1280]}
ysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddl
yeeytewlkf

SCOPe Domain Coordinates for d2o6ka1:

Click to download the PDB-style file with coordinates for d2o6ka1.
(The format of our PDB-style files is described here.)

Timeline for d2o6ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o6ka2