SCOPe 2.06: Domain d2o6gg_: 2o6g G:

Lineage for d2o6gg_ (2o6g G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
   Pfam PF00605

6. Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries)
   Uniprot Q14653 3-112

8. Domain d2o6gg_: 2o6g G: [148630]
   automated match to d2pi0b_
   protein/DNA complex

Details for d2o6gg_

PDB Entry: 2o6g, 3.1 Å

PDB Description: crystal structure of irf-3 bound to the interferon-b enhancer

PDB Compounds: (G:) Interferon regulatory factor 3

SCOPe Domain Sequences for d2o6gg_:

Sequence; same for both SEQRES and ATOM records:

>d2o6gg_ a.4.5.23 (G:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]}
tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg
ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns

Timeline for d2o6gg_:

• d2o6gg_ first appeared in SCOP 1.75, called d2o6gg1
  
• d2o6gg_ appears in SCOPe 2.05
  
• d2o6gg_ appears in SCOPe 2.07
  
• d2o6gg_ appears in the current release, SCOPe 2.08