Lineage for d2o6ge1 (2o6g E:3-112)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762298Family a.4.5.23: Interferon regulatory factor [46877] (3 proteins)
    Pfam PF00605
  6. 762303Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)
  7. 762304Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries)
    Uniprot Q14653 3-112
  8. 762309Domain d2o6ge1: 2o6g E:3-112 [148628]
    automatically matched to d1t2ka_

Details for d2o6ge1

PDB Entry: 2o6g (more details), 3.1 Å

PDB Description: crystal structure of irf-3 bound to the interferon-b enhancer
PDB Compounds: (E:) Interferon regulatory factor 3

SCOP Domain Sequences for d2o6ge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6ge1 a.4.5.23 (E:3-112) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]}
tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg
ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns

SCOP Domain Coordinates for d2o6ge1:

Click to download the PDB-style file with coordinates for d2o6ge1.
(The format of our PDB-style files is described here.)

Timeline for d2o6ge1: