Lineage for d2o6ba1 (2o6b A:5-144)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.1: 4HBT-like [54638] (19 proteins)
Pfam PF03061
Protein Hypothetical thioesterase PA5185 [143158] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
Uniprot Q9HU04 5-146
Domain d2o6ba1: 2o6b A:5-144 [148626]
automatically matched to d2av9a1
Details for d2o6ba1
PDB Entry: 2o6b (more details), 3.21 Å
PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- new crystal form.
PDB Compounds: (A:) thioesteraseSCOPe Domain Sequences for d2o6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6ba1 d.38.1.1 (A:5-144) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
ssrpvaipqelrdalaalqs
SCOPe Domain Coordinates for d2o6ba1:
Click to download the PDB-style file with coordinates for d2o6ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o6ba1:
- d2o6ba1 first appeared in SCOP 1.75
- d2o6ba1 appears in SCOPe 2.07
View in 3D
