SCOPe 2.07: Domain d2o62b2: 2o62 B:1-132

Lineage for d2o62b2 (2o62 B:1-132)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.9: All1756-like [159230] (1 protein)
   cyanobacterial proteins with duplicated fatty acid binding protein-like domains; N-terminal and C-terminal domains correspond to PfamB 40396 and PfamB 60468, respectively

6. Protein Uncharacterized protein All1756 ortholog [159231] (1 species)

7. Species Nostoc punctiforme [TaxId:272131] [159232] (1 PDB entry)

8. Domain d2o62b2: 2o62 B:1-132 [148625]
   automated match to d2o62a2
   complexed with cl, gol

Details for d2o62b2

PDB Entry: 2o62, 1.75 Å

PDB Description: crystal structure of a protein with unknown function from duf3598 family (npun_r4044) from nostoc punctiforme pcc 73102 at 1.75 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2o62b2:

Sequence; same for both SEQRES and ATOM records:

>d2o62b2 b.60.1.9 (B:1-132) Uncharacterized protein All1756 ortholog {Nostoc punctiforme [TaxId: 272131]}
mksqwecflqnlgvwegsfsnfspegtllndtssrlcleglnnnqtvrltlsrsgkddvi
refrsvgggllffengsfsegliqlgpfsefggelafvhenrrlrlvqlfdrnghlnglt
lirehlagtpva

Timeline for d2o62b2:

• d2o62b2 first appeared in SCOP 1.75
  
• d2o62b2 appears in SCOPe 2.06
  
• d2o62b2 appears in the current release, SCOPe 2.08