![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.9: All1756-like [159230] (1 protein) cyanobacterial proteins with duplicated fatty acid binding protein-like domains; N-terminal and C-terminal domains correspond to PfamB 40396 and PfamB 60468, respectively |
![]() | Protein Uncharacterized protein All1756 ortholog [159231] (1 species) |
![]() | Species Nostoc punctiforme [TaxId:272131] [159232] (1 PDB entry) |
![]() | Domain d2o62b1: 2o62 B:133-269 [148624] automated match to d2o62a1 complexed with cl, gol |
PDB Entry: 2o62 (more details), 1.75 Å
SCOPe Domain Sequences for d2o62b1:
Sequence, based on SEQRES records: (download)
>d2o62b1 b.60.1.9 (B:133-269) Uncharacterized protein All1756 ortholog {Nostoc punctiforme [TaxId: 272131]} erpllqindllgewrgqavtiyrdlrppdiysttlkiqlddagrlmqstsfgertitsta tikgsivlfdqdpekqvqvlllpdgasatsplkvqlrqplfleagwliqsdlrqrmirsy ndkgewvsltlvteerv
>d2o62b1 b.60.1.9 (B:133-269) Uncharacterized protein All1756 ortholog {Nostoc punctiforme [TaxId: 272131]} erpllqindllgewrgqavtiyrdrppdiysttlkiqlddagrlmqstsfgertitstat ikgsivlfdqdpekqvqvlllpdgasatsplkvqlrqplfleagwliqsdlrqrmirsyn dkgewvsltlvteerv
Timeline for d2o62b1: