SCOPe 2.07: Domain d2o61b2: 2o61 B:37-250

Lineage for d2o61b2 (2o61 B:37-250)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49424] (2 PDB entries)

8. Domain d2o61b2: 2o61 B:37-250 [148621]
   Other proteins in same PDB: d2o61b1
   automated match to d1nfka2
   protein/DNA complex

Details for d2o61b2

PDB Entry: 2o61, 2.8 Å

PDB Description: crystal structure of nfkb, irf7, irf3 bound to the interferon-b enhancer

PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2o61b2:

Sequence; same for both SEQRES and ATOM records:

>d2o61b2 b.2.5.3 (B:37-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mdgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivq
lvtngknihlhahslvgkhcedgictvtagpkdmvvgfanlgilhvtkkkvfetlearmt
eacirgynpgllvhpdlaylqaegggdrqlgdrekelirqaalqqtkemdlsvvrlmfta
flpdstgsftrrlepvvsdaiydskapnasnlki

Timeline for d2o61b2:

• d2o61b2 first appeared in SCOP 1.75
  
• d2o61b2 appears in SCOPe 2.06
  
• d2o61b2 appears in the current release, SCOPe 2.08