Lineage for d2o61b2 (2o61 B:38-250)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768236Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2768240Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 2768241Species Human (Homo sapiens) [TaxId:9606] [49424] (2 PDB entries)
  8. 2768243Domain d2o61b2: 2o61 B:38-250 [148621]
    Other proteins in same PDB: d2o61b1, d2o61b3
    automated match to d1nfka2
    protein/DNA complex

Details for d2o61b2

PDB Entry: 2o61 (more details), 2.8 Å

PDB Description: crystal structure of nfkb, irf7, irf3 bound to the interferon-b enhancer
PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2o61b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o61b2 b.2.5.3 (B:38-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
vtngknihlhahslvgkhcedgictvtagpkdmvvgfanlgilhvtkkkvfetlearmte
acirgynpgllvhpdlaylqaegggdrqlgdrekelirqaalqqtkemdlsvvrlmftaf
lpdstgsftrrlepvvsdaiydskapnasnlki

SCOPe Domain Coordinates for d2o61b2:

Click to download the PDB-style file with coordinates for d2o61b2.
(The format of our PDB-style files is described here.)

Timeline for d2o61b2: