Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49249] (9 PDB entries) Uniprot P25799 245-350 |
Domain d2o61b1: 2o61 B:247-350 [148620] Other proteins in same PDB: d2o61b2 automatically matched to d1nfib_ |
PDB Entry: 2o61 (more details), 2.8 Å
SCOP Domain Sequences for d2o61b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o61b1 b.1.18.1 (B:247-350) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq faivfktpkykdinitkpasvfvqlrrksdletsepkpflyype
Timeline for d2o61b1: