Lineage for d2o5ua2 (2o5u A:1-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943607Protein Hypothetical thioesterase PA5185 [143158] (1 species)
  7. 2943608Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
    Uniprot Q9HU04 5-146
  8. 2943609Domain d2o5ua2: 2o5u A:1-143 [148616]
    Other proteins in same PDB: d2o5ua3
    automated match to d2av9a1

Details for d2o5ua2

PDB Entry: 2o5u (more details), 1.91 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (c222).
PDB Compounds: (A:) thioesterase

SCOPe Domain Sequences for d2o5ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5ua2 d.38.1.1 (A:1-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
mataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgge
viglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvf
verrssrpvaipqelrdalaalq

SCOPe Domain Coordinates for d2o5ua2:

Click to download the PDB-style file with coordinates for d2o5ua2.
(The format of our PDB-style files is described here.)

Timeline for d2o5ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o5ua3