Lineage for d2o5qx_ (2o5q X:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717381Species Horse (Equus caballus) [TaxId:9796] [46474] (80 PDB entries)
  8. 1717437Domain d2o5qx_: 2o5q X: [148613]
    automated match to d1azia_
    complexed with mnh, no, so4

Details for d2o5qx_

PDB Entry: 2o5q (more details), 1.9 Å

PDB Description: Manganese horse heart myoglobin, nitric oxide modified
PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2o5qx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5qx_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d2o5qx_:

Click to download the PDB-style file with coordinates for d2o5qx_.
(The format of our PDB-style files is described here.)

Timeline for d2o5qx_: