Lineage for d2o5lx_ (2o5l X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301307Protein Myoglobin [46469] (10 species)
  7. 2301312Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)
  8. 2301352Domain d2o5lx_: 2o5l X: [148610]
    automated match to d1azia_
    complexed with mnr, moh, so4

Details for d2o5lx_

PDB Entry: 2o5l (more details), 1.7 Å

PDB Description: Manganese horse heart myoglobin, methanol modified
PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2o5lx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5lx_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d2o5lx_:

Click to download the PDB-style file with coordinates for d2o5lx_.
(The format of our PDB-style files is described here.)

Timeline for d2o5lx_: