SCOPe 2.08: Domain d2o5lx_: 2o5l X:

Lineage for d2o5lx_ (2o5l X:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)

8. Domain d2o5lx_: 2o5l X: [148610]
   automated match to d1azia_
   complexed with mnr, moh, so4

Details for d2o5lx_

PDB Entry: 2o5l, 1.7 Å

PDB Description: Manganese horse heart myoglobin, methanol modified

PDB Compounds: (X:) Myoglobin

SCOPe Domain Sequences for d2o5lx_:

Sequence; same for both SEQRES and ATOM records:

>d2o5lx_ a.1.1.2 (X:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d2o5lx_:

• d2o5lx_ first appeared in SCOP 1.75, called d2o5lx1
  
• d2o5lx_ appears in SCOPe 2.07