Lineage for d2o5ka1 (2o5k A:35-384)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874838Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 874839Species Human (Homo sapiens) [TaxId:9606] [69824] (16 PDB entries)
    Uniprot P49841 35-383
    Uniprot P49841 35-384
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 874868Domain d2o5ka1: 2o5k A:35-384 [148609]
    automatically matched to d1j1bb_
    complexed with hbm

Details for d2o5ka1

PDB Entry: 2o5k (more details), 3.2 Å

PDB Description: Crystal Structure of GSK3beta in complex with a benzoimidazol inhibitor
PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOP Domain Sequences for d2o5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5ka1 d.144.1.7 (A:35-384) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

SCOP Domain Coordinates for d2o5ka1:

Click to download the PDB-style file with coordinates for d2o5ka1.
(The format of our PDB-style files is described here.)

Timeline for d2o5ka1: