Lineage for d2o5jn_ (2o5j N:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694889Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 1694951Protein automated matches [254473] (5 species)
    not a true protein
  7. 1694958Species Thermus thermophilus HB8 [TaxId:300852] [255520] (3 PDB entries)
  8. 1694960Domain d2o5jn_: 2o5j N: [148608]
    Other proteins in same PDB: d2o5jc_, d2o5je_, d2o5jm_, d2o5jo_
    automated match to d4g7od_
    protein/DNA complex; protein/RNA complex; complexed with apc, mg, zn

Details for d2o5jn_

PDB Entry: 2o5j (more details), 3 Å

PDB Description: Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the NTP substrate analog
PDB Compounds: (N:) DNA-directed RNA polymerase beta' chain

SCOPe Domain Sequences for d2o5jn_:

Sequence, based on SEQRES records: (download)

>d2o5jn_ e.29.1.2 (N:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d2o5jn_ e.29.1.2 (N:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfasilvvkarvypfeddvevstgdrvapgdvladg
gkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemkhp
srarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndly
rrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrslt
dilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeek
giapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegq
siqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrd
iilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyvfa
npdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliqldv
pqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkqyl
eeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyvma
qsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkggadt
alrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradieagl
ygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcqkc
ygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvielfe
arrpkakaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

SCOPe Domain Coordinates for d2o5jn_:

Click to download the PDB-style file with coordinates for d2o5jn_.
(The format of our PDB-style files is described here.)

Timeline for d2o5jn_: