Lineage for d2o5jc_ (2o5j C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574312Protein automated matches [190192] (4 species)
    not a true protein
  7. 2574321Species Thermus thermophilus HB8 [TaxId:300852] [187303] (4 PDB entries)
  8. 2574324Domain d2o5jc_: 2o5j C: [148605]
    Other proteins in same PDB: d2o5jd_, d2o5je_, d2o5jn_, d2o5jo_
    automated match to d1smyc_
    protein/DNA complex; protein/RNA complex; complexed with apc, mg, zn

Details for d2o5jc_

PDB Entry: 2o5j (more details), 3 Å

PDB Description: Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the NTP substrate analog
PDB Compounds: (C:) DNA-directed RNA polymerase beta chain

SCOPe Domain Sequences for d2o5jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5jc_ e.29.1.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d2o5jc_:

Click to download the PDB-style file with coordinates for d2o5jc_.
(The format of our PDB-style files is described here.)

Timeline for d2o5jc_: