Lineage for d2o5ha1 (2o5h A:1-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011601Fold d.363: NMB0513-like [160471] (1 superfamily)
    alpha(3)-beta(2)-alpha-beta(2); some similarity to the "winged helix" DNA-binding domain fold
  4. 3011602Superfamily d.363.1: NMB0513-like [160472] (1 family) (S)
  5. 3011603Family d.363.1.1: NMB0513-like [160473] (1 protein)
    C-terminal part corresponds to Pfam PF04591, DUF596
  6. 3011604Protein Hypothetical protein NMB0513 [160474] (1 species)
  7. 3011605Species Neisseria meningitidis [TaxId:487] [160475] (1 PDB entry)
    Uniprot Q9K0R7 1-131
  8. 3011606Domain d2o5ha1: 2o5h A:1-131 [148599]
    Other proteins in same PDB: d2o5ha2

Details for d2o5ha1

PDB Entry: 2o5h (more details), 1.9 Å

PDB Description: uncharacterized protein conserved in bacteria, cog3792 from neisseria meningitidis
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2o5ha1:

Sequence, based on SEQRES records: (download)

>d2o5ha1 d.363.1.1 (A:1-131) Hypothetical protein NMB0513 {Neisseria meningitidis [TaxId: 487]}
mrklnnhdvhkryqdrleedveftinyelplsclwstikdfssdfeekteaffilfkell
rrghlklqrdgqiightpeeweqifrevwpeyeiepnplpgyapfdigmwltveapayav
widpedgseyw

Sequence, based on observed residues (ATOM records): (download)

>d2o5ha1 d.363.1.1 (A:1-131) Hypothetical protein NMB0513 {Neisseria meningitidis [TaxId: 487]}
mrklnnhdvhkryqdrleedveftinyelplsclwstikdfssdfeekteaffilfkell
rrghlklqrdgqiightpeeweqifrevwpeyeiepnpfdigmwltveapayavwidped
gseyw

SCOPe Domain Coordinates for d2o5ha1:

Click to download the PDB-style file with coordinates for d2o5ha1.
(The format of our PDB-style files is described here.)

Timeline for d2o5ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o5ha2
View in 3D
Domains from other chains:
(mouse over for more information)
d2o5hb_