Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
Protein Hypothetical protein DR0079 [103217] (2 species) |
Species Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId:243230] [160692] (1 PDB entry) |
Domain d2o5fb_: 2o5f B: [148597] automated match to d1q27a_ |
PDB Entry: 2o5f (more details), 1.9 Å
SCOPe Domain Sequences for d2o5fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5fb_ d.113.1.2 (B:) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} erldlvnerdevvgqilrtdpalrwervrvvnaflrnsqgqlwiprrspskslfpnaldv svggavqsgetyeeafrreareelnveidalswrplasfspfqttlssfmcvyelrsdat pifnpndisggewltpehllariaageaakgdlaelvrrcyr
Timeline for d2o5fb_: