Lineage for d2o5bx1 (2o5b X:1-152)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759581Species Horse (Equus caballus) [TaxId:9796] [46474] (45 PDB entries)
  8. 759621Domain d2o5bx1: 2o5b X:1-152 [148595]
    automatically matched to d1azia_
    complexed with mnh, so4

Details for d2o5bx1

PDB Entry: 2o5b (more details), 2 Å

PDB Description: Manganese horse heart myoglobin, reduced
PDB Compounds: (X:) Myoglobin

SCOP Domain Sequences for d2o5bx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5bx1 a.1.1.2 (X:1-152) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOP Domain Coordinates for d2o5bx1:

Click to download the PDB-style file with coordinates for d2o5bx1.
(The format of our PDB-style files is described here.)

Timeline for d2o5bx1: